Gene Mb3777
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable integrase (fragment) |
Comments | Mb3777, -, len: 71 aa. Equivalent to Rv3751, len: 71 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 71 aa overlap). Probable integrase (fragment), similar to part of many e.g. Q48908 INTEGRASE (FRAGMENT) from Mycobacterium paratuberculosis (191 aa),FASTA scores: opt: 206, E(): 5.5e-08, (57.65% identity in 59 aa overlap); Q9ZWV7|INT INTEGRASE from Corynephage 304L (395 aa), FASTA scores: opt: 156, E(): 0.00036, (45.75% identity in 59 aa overlap); Q9K722|BH3551 INTEGRASE (PHAGE-RELATED PROTEIN) from Bacillus halodurans (378 aa),FASTA scores: opt: 151, E(): 0.00079, (46.15% identity in 52 aa overlap); etc. Also similarity with various conjugative transposons. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. P71903|Rv2309c|MTCY3G12.25 (151 aa), FASTA scores: opt: 193, E(): 3.8e-07, (50.85% identity in 59 aa overlap); O53403|Rv1055|MTV017.08 (78 aa), FASTA scores: opt: 171,E(): 7.8e-06, (54.15% identity in 48 aa overlap); etc. |
Functional category | Insertion seqs and phages |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4135168 | 4135383 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3777|Mb3777 MKRAKVQQITPHDLRHTAASLAVSAGVNVLALQRILGHKSAKVTLDTYADLFDADLDAVAVTLGKDADQQT
Bibliography
No article yet recorded