Gene Rv3759c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of osmoprotectant (glycine betaine/carnitine/choline/L-proline) across the membrane (import). |
| Product | Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) binding lipoprotein ProX |
| Comments | Rv3759c, (MTV025.107c), len: 315 aa. Possible proX, osmoprotectant-binding lipoprotein component of osmoprotectant transport system (see citation below), similar to osmoprotection proteins (proX) involved in glycine betaine/L-proline/choline transport, e.g. AAK79442|CAC1474 proline/glycine betaine ABC transport system periplasmic component from Clostridium acetobutylicum (303 aa), FASTA scores: opt: 308, E(): 1.2e-11, (27.4% identity in 314 aa overlap); Q9X4J2|PROXL|SCE19A.33 PROXL protein from Streptomyces coelicolor (322 aa), FASTA scores: opt: 302, E(): 3e-11, (27.2% identity in 327 aa overlap); O29280|AF0982 osmoprotection protein (PROX) from Archaeoglobus fulgidus (292 aa), FASTA scores: opt: 235, E(): 3.4e-07, (23.15% identity in 285 aa overlap); etc. Also similar to MTV006_16 hypothetical protein from Mycobacterium tuberculosis, and MLU15180_43 hypothetical protein from Mycobacterium leprae. Equivalent to AAK48230 from Mycobacterium tuberculosis strain CDC1551 (343 aa) but shorter 28 aa. Contains probable N-terminal signal sequence. |
| Functional category | - |
| Proteomics | Predicted secreted protein/surface lipoprotein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4204426 | 4205373 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3759c|proX
MRMLRRLRRATVAAAVWLATVCLVASCANADPLGSATGSVKSIVVGSGDFPESQVIAEIYAQVLQANGFDVGRRLGIGSRETYILALKDHSIDLVPEYIGNLLLYFQPDATVTMLDAVELELYKRLPGDLSILTPSPASDTDTVTVTAATAARWNLKTIADLAPHSADVKFAAPSAFQTRPSGLPGLRHKYSLDIAPGNFVTINDGGGAVTVRALVEGTATAANLFSTSAAIPQNHLVVLEDPEHNFLAGNIVPLVNSRKKSDHLKDVLDAVSAKLTTAGLAELNAAVSGNSGVDPDQAARKWVRDNGFDHPVRQ
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant