Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in active transport of osmoprotectant (glycine betaine/carnitine/choline/L-proline) across the membrane (import).
ProductPossible osmoprotectant (glycine betaine/carnitine/choline/L-proline) binding lipoprotein ProX
CommentsRv3759c, (MTV025.107c), len: 315 aa. Possible proX, osmoprotectant-binding lipoprotein component of osmoprotectant transport system (see citation below), similar to osmoprotection proteins (proX) involved in glycine betaine/L-proline/choline transport, e.g. AAK79442|CAC1474 proline/glycine betaine ABC transport system periplasmic component from Clostridium acetobutylicum (303 aa), FASTA scores: opt: 308, E(): 1.2e-11, (27.4% identity in 314 aa overlap); Q9X4J2|PROXL|SCE19A.33 PROXL protein from Streptomyces coelicolor (322 aa), FASTA scores: opt: 302, E(): 3e-11, (27.2% identity in 327 aa overlap); O29280|AF0982 osmoprotection protein (PROX) from Archaeoglobus fulgidus (292 aa), FASTA scores: opt: 235, E(): 3.4e-07, (23.15% identity in 285 aa overlap); etc. Also similar to MTV006_16 hypothetical protein from Mycobacterium tuberculosis, and MLU15180_43 hypothetical protein from Mycobacterium leprae. Equivalent to AAK48230 from Mycobacterium tuberculosis strain CDC1551 (343 aa) but shorter 28 aa. Contains probable N-terminal signal sequence.
Functional category-
ProteomicsPredicted secreted protein/surface lipoprotein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42044264205373-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3759c|proX
MRMLRRLRRATVAAAVWLATVCLVASCANADPLGSATGSVKSIVVGSGDFPESQVIAEIYAQVLQANGFDVGRRLGIGSRETYILALKDHSIDLVPEYIGNLLLYFQPDATVTMLDAVELELYKRLPGDLSILTPSPASDTDTVTVTAATAARWNLKTIADLAPHSADVKFAAPSAFQTRPSGLPGLRHKYSLDIAPGNFVTINDGGGAVTVRALVEGTATAANLFSTSAAIPQNHLVVLEDPEHNFLAGNIVPLVNSRKKSDHLKDVLDAVSAKLTTAGLAELNAAVSGNSGVDPDQAARKWVRDNGFDHPVRQ