Gene Rv3770B
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of an insertion element. |
| Product | Probable remnant of a transposase |
| Comments | Rv3770B, len: 63 aa. Probable remnant of a transposase, similar to many e.g. Rv2812|MTCY16B7.31c|Z81331_17 IS1604 putative transposase from Mycobacterium tuberculosis (469 aa), FASTA scores: opt: 379, E(): 1.6e-21, (93.55% identity in 62 aa overlap). Continues as Rv3770A. |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4216078 | 4216269 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3770B|Rv3770B
VRAERARAIGLFRYQLIREAADAAHSTKERGKMVRELASREHTDPFGRKVRISRHTIDRWIRN
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
