Gene Rv3771c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3771c, (MTCY13D12.05c), len: 108 aa. Hypothetical protein, highly similar, but shorter 81 aa, to P71640|Rv2811|MTCY16B7.32c hypothetical 21.1 KDA protein from Mycobacterium tuberculosis (202 aa), FASTA scores: opt: 469, E(): 2.7e-25, (73.15% identity in 108 aa overlap) |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4216404 | 4216730 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3771c|Rv3771c
VPAPAEKALSQVGFRRIAADLARPAETVRGWLRRFAERAEAVRSVFTVMLRAVDPDPVMPDAAVGVFAYAVTVIAAVVTVIECQFALSTVSLAETAVAVSGGRLVAPG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
