Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionKey enzyme in the catabolic pathway of odd-chain fatty acids, isoleucine, threonine, methionine, and valine [catalytic activity: ATP + propionyl-CoA + CO(2) + H(2)O = ADP + orthophosphate + methylmalonyl-CoA.]
ProductProbable propionyl-CoA carboxylase beta chain 4 AccD4 (pccase) (propanoyl-CoA:carbon dioxide ligase)
CommentsRv3799c, (MTV026.04c), len: 522 aa. Probable accD4, propionyl-CoA carboxylase beta chain 4, equivalent to Q9CDB0|ACCD4|ML0102 putative acyl CoA carboxylase from Mycobacterium leprae (517 aa) FASTA scores: opt: 3154, E(): 8e-187, (91.2% identity in 511 aa overlap). Also similar to many e.g. Q9X4K7|PCCB from Streptomyces coelicolor (530 aa), FASTA scores: opt: 1714, E(): 4.4e-98, (50.0% identity in 510 aa overlap); P53003|PCCB_SACER from Saccharopolyspora erythraea (Streptomyces erythraeus) (546 aa), FASTA scores: opt: 1549, E(): 6.6e-88, (50.65% identity in 519 aa overlap); Q9WZH5|TM0716 from Thermotoga maritima (515 aa) FASTA scores: opt: 1529, E(): 1.1e-86, (46.7% identity in 512 aa overlap); etc. Also similar to P53002|PCCB_MYCLE|ACCD5|PCCB|ML0731|B1308_C1_125 probable propionyl-CoA carboxylase beta chain 5 from Mycobacterium leprae (549 aa), FASTA scores: opt: 1493, E(): 1.9e-84, (49.8% identity in 514 aa overlap); and P96885|PCC5_MYCTU|ACCD5|PCCB|Rv3280|MT3379.1|MTCY71.20 probable propionyl-CoA carboxylase beta chain 5 from Mycobacterium tuberculosis (548 aa), FASTA scores: opt: 1471, E(): 4.2e-83, (49.15% identity in 515 aa overlap). Belongs to the ACCD/PCCB family. Length extended since first submission (+5 aa). AccA3 (Rv3285), AccD5 (Rv3280), AccD4 (Rv3799), and AccE5 (Rv3281) form a biotin-dependent acyl-CoA carboxylase in M. tuberculosis H37Rv (See Oh et al., 2006).
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42543804255948-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3799c|accD4
VTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIYELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTVFGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAELGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLPSNCFDKPPVVNPGLEPEITGHDLELDSIVPDSDNMAYDMHEVLLRIFDDGDFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARFIRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKVTITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFPDPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKSMHLLRDKQLWWRVGRKHGLIPV
      
Bibliography