Gene Rv3799c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Key enzyme in the catabolic pathway of odd-chain fatty acids, isoleucine, threonine, methionine, and valine [catalytic activity: ATP + propionyl-CoA + CO(2) + H(2)O = ADP + orthophosphate + methylmalonyl-CoA.] |
| Product | Probable propionyl-CoA carboxylase beta chain 4 AccD4 (pccase) (propanoyl-CoA:carbon dioxide ligase) |
| Comments | Rv3799c, (MTV026.04c), len: 522 aa. Probable accD4, propionyl-CoA carboxylase beta chain 4, equivalent to Q9CDB0|ACCD4|ML0102 putative acyl CoA carboxylase from Mycobacterium leprae (517 aa) FASTA scores: opt: 3154, E(): 8e-187, (91.2% identity in 511 aa overlap). Also similar to many e.g. Q9X4K7|PCCB from Streptomyces coelicolor (530 aa), FASTA scores: opt: 1714, E(): 4.4e-98, (50.0% identity in 510 aa overlap); P53003|PCCB_SACER from Saccharopolyspora erythraea (Streptomyces erythraeus) (546 aa), FASTA scores: opt: 1549, E(): 6.6e-88, (50.65% identity in 519 aa overlap); Q9WZH5|TM0716 from Thermotoga maritima (515 aa) FASTA scores: opt: 1529, E(): 1.1e-86, (46.7% identity in 512 aa overlap); etc. Also similar to P53002|PCCB_MYCLE|ACCD5|PCCB|ML0731|B1308_C1_125 probable propionyl-CoA carboxylase beta chain 5 from Mycobacterium leprae (549 aa), FASTA scores: opt: 1493, E(): 1.9e-84, (49.8% identity in 514 aa overlap); and P96885|PCC5_MYCTU|ACCD5|PCCB|Rv3280|MT3379.1|MTCY71.20 probable propionyl-CoA carboxylase beta chain 5 from Mycobacterium tuberculosis (548 aa), FASTA scores: opt: 1471, E(): 4.2e-83, (49.15% identity in 515 aa overlap). Belongs to the ACCD/PCCB family. Length extended since first submission (+5 aa). AccA3 (Rv3285), AccD5 (Rv3280), AccD4 (Rv3799), and AccE5 (Rv3281) form a biotin-dependent acyl-CoA carboxylase in M. tuberculosis H37Rv (See Oh et al., 2006). |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4254380 | 4255948 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3799c|accD4
VTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIYELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTVFGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAELGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLPSNCFDKPPVVNPGLEPEITGHDLELDSIVPDSDNMAYDMHEVLLRIFDDGDFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARFIRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKVTITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFPDPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKSMHLLRDKQLWWRVGRKHGLIPV
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Oh TJ et al. [2006]. Identification and characterization of Rv3281 as a novel subunit of a biotin-dependent acyl-CoA Carboxylase in Mycobacterium tuberculosis H37Rv. Function
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant