Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in arabinogalactan synthesis [catalytic activity: phosphoribose diphosphate + decaprenyl phosphate = decaprenylphosphoryl-5-phosphoribose + diphosphate]
ProductDecaprenylphosphoryl-5-phosphoribose (DPPR) synthase (decaprenyl-phosphate 5-phosphoribosyltransferase)
CommentsRv3806c, (MTV026.11c), len: 302 aa. UbiA, decaprenylphosphoryl-5-phosphoribose (DPPR) synthase (See Huang et al., 2005), equivalent to Q9CDB5|ML0095 putative integral membrane protein from Mycobacterium leprae (302 aa), FASTA scores: opt: 1677, E(): 3.9e-103, (83.75% identity in 302 aa overlap). Also highly similar to others e.g. Q9KZA2|SC5G8.12 putative integral membrane protein from Streptomyces coelicolor (322 aa), FASTA scores: opt: 937, E(): 2e-54, (51.4% identity in 292 aa overlap); AAK79783|CAC1818 conserved membrane protein, possible 4-hydroxybenzoate from Clostridium acetobutylicum (290 aa), FASTA scores: opt: 467, E(): 1.5e-23, (26.9% identity in 290 aa overlap); Q98KY3|MLL1266 nodulation protein NOEC (potential integral membrane protein) from Rhizobium loti (Mesorhizobium loti) (297 aa), FASTA scores: opt: 331, E(): 1.4e-14, (27.4% identity in 299 aa overlap); etc. And highly similar to C-terminal part of Q981F8|MLR9393 nodulation protein NOEC (potential integral membrane protein) from Rhizobium loti (Mesorhizobium loti) plasmid pMLa (541 aa), FASTA scores: opt: 388, E(): 4e-18, (30.9% identity in 301 aa overlap); and P55585|Y4NM_RHISN integral membrane protein (possible permease/transporter) from Rhizobium sp. strain NGR234 plasmid sym pNGR234a (516 aa), FASTA scores: opt: 380, E(): 1.3e-17, (31.85% identity in 295 aa overlap). Contains PS00225 Crystallins beta and gamma 'Greek key' motif signature.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42689254269833-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3806c|ubiA
MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFVVFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWMLTPNLALVMVVYLAMQLAYCFGLKHQAVVEICVVSSAYLIRAIAGGVATKIPLSKWFLLIMAFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFERDGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVAFG
      
Bibliography