Gene Rv3806c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in arabinogalactan synthesis [catalytic activity: phosphoribose diphosphate + decaprenyl phosphate = decaprenylphosphoryl-5-phosphoribose + diphosphate] |
| Product | Decaprenylphosphoryl-5-phosphoribose (DPPR) synthase (decaprenyl-phosphate 5-phosphoribosyltransferase) |
| Comments | Rv3806c, (MTV026.11c), len: 302 aa. UbiA, decaprenylphosphoryl-5-phosphoribose (DPPR) synthase (See Huang et al., 2005), equivalent to Q9CDB5|ML0095 putative integral membrane protein from Mycobacterium leprae (302 aa), FASTA scores: opt: 1677, E(): 3.9e-103, (83.75% identity in 302 aa overlap). Also highly similar to others e.g. Q9KZA2|SC5G8.12 putative integral membrane protein from Streptomyces coelicolor (322 aa), FASTA scores: opt: 937, E(): 2e-54, (51.4% identity in 292 aa overlap); AAK79783|CAC1818 conserved membrane protein, possible 4-hydroxybenzoate from Clostridium acetobutylicum (290 aa), FASTA scores: opt: 467, E(): 1.5e-23, (26.9% identity in 290 aa overlap); Q98KY3|MLL1266 nodulation protein NOEC (potential integral membrane protein) from Rhizobium loti (Mesorhizobium loti) (297 aa), FASTA scores: opt: 331, E(): 1.4e-14, (27.4% identity in 299 aa overlap); etc. And highly similar to C-terminal part of Q981F8|MLR9393 nodulation protein NOEC (potential integral membrane protein) from Rhizobium loti (Mesorhizobium loti) plasmid pMLa (541 aa), FASTA scores: opt: 388, E(): 4e-18, (30.9% identity in 301 aa overlap); and P55585|Y4NM_RHISN integral membrane protein (possible permease/transporter) from Rhizobium sp. strain NGR234 plasmid sym pNGR234a (516 aa), FASTA scores: opt: 380, E(): 1.3e-17, (31.85% identity in 295 aa overlap). Contains PS00225 Crystallins beta and gamma 'Greek key' motif signature. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4268925 | 4269833 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3806c|ubiA
MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFVVFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWMLTPNLALVMVVYLAMQLAYCFGLKHQAVVEICVVSSAYLIRAIAGGVATKIPLSKWFLLIMAFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFERDGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVAFG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Huang H et al. [2005]. Identification and active expression of the Mycobacterium tuberculosis gene encoding 5-phospho-{alpha}-d-ribose-1-diphosphate: decaprenyl-phosphate 5-phosphoribosyltransferase, the first enzyme committed to decaprenylphosphoryl-d-arabinose synthesis. Function Product
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant