Gene Rv3811 (csp)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3811, (MTV026.16), len: 539 aa. Conserved hypothetical protein, showing some similarity to Q9KZK5|SCE34.21c putative secreted protein from Streptomyces coelicolor (416 aa), FASTA scores: opt: 603, E(): 8.1e-26, (34.4% identity in 404 aa overlap); Q9S2P9|SC5F7.14c hypothetical 31.9 KDA protein from Streptomyces coelicolor (308 aa), FASTA scores: opt: 472, E(): 9.5e-19, (37.5% identity in 208 aa overlap). Middle section (approximately aa 185-350/390) shows some similarity with Q9GK12 peptidoglycan recognition protein precursor from Camelus dromedarius (Dromedary) (Arabian camel) (193 aa) FASTA scores: opt: 274, E(): 4.6e-08, (32.2% identity in 177 aa overlap); O75594|PGLYRP|PGRP from Homo sapiens (Human) (196 aa), FASTA scores: opt: 272, E(): 6e-08, (30.9% identity in 220 aa overlap); Q9JLN4|PGRP peptidoglycan recognition protein from Rattus norvegicus (Rat) (182 aa), FASTA scores: opt: 253, E(): 6.2e-07, (32.15% identity in 171 aa overlap); etc. C-terminal end shows similarity with Q01377|CSP1_CORGL PS1 protein precursor (one of the two major secreted proteins) from Corynebacterium glutamicum (Brevibacterium flavum) (657 aa), FASTA scores: opt: 250, E(): 2.7e-06, (39.45% identity in 109 aa overlap). Contains PS00687 Aldehydedehydrogenases glutamic acid active site. Note that previously known as csp. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4274798 | 4276417 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3811|Rv3811
MAATVVIVAWIANRPPASSHEPSPTPNTQLAEQPLIGLGGGVTVRELTQDTPFSLVALTGDLAGTSARVRAKRPDGDWGPWYQTEYETEPRDPAGTDGSVELGGLNPGPRSTDPVFVGTTTTVQVAVTRPIDAPITQPPAGRPPNDLLDSGLGYRPATKEQPFGQNISAILISPPQAPPGTQWTPPTAVTMAGQPPAIISRAEWGADESLRCETPEYDRGVRAAVVHHTAGSNDYSPLESAGIVKAIYTYHSKTLGWCDIAYNALVDKYGQVFEGSAGGLTKPVEGFHTGGFNRNTWGVAMIGNFDDVAPTPIQIRTVGRLLGWRLGMDDVDPRSMVDLQSAGSSYTTFPGGAIARLPAIFTHRDVGNTDCPGNAAYAVMDEIRDIAAHFNDPPEELIKALEGGAIYQRWQALGGMNSALGAPTSPEADAADGARYATFAKGAMYWSPVTDAQPITGAIYEAWASQSYERGPLGLPTSAEIQEPLQITQNFQHGTLNFERLTGNVTEVVDGITTPLATRPPSGPTVPPEHFTLPTHPIT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
