Gene Rv3813c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3813c, (MTCY409.17), len: 273 aa. Conserved protein, equivalent to Q9CDB9|ML0089 hypothetical protein from Mycobacterium leprae (281 aa) FASTA scores: opt: 1479, E(): 9.6e-81, (80.45% identity in 271 aa overlap); and similar to Q98LI0|MLL1014 from (280 aa). Also similar to many hypothetical proteins from several organisms e.g. Q9ZBX2|SCD78.27c from Streptomyces coelicolor (280 aa), FASTA scores: opt: 597, E(): 2.2e-28, (43.25% identity in 266 aa overlap); Q9RXR7|DR0240 from Deinococcus radiodurans (284 aa), FASTA scores: opt: 543, E(): 3.5e-25, (38.65% identity in 264 aa overlap); Q99YH5|SPY1700 from Streptococcus pyogenes (274 aa) FASTA scores: opt: 373, E(): 4.3e-15, (30.75% identity in 270 aa overlap); P70947|YITU from Bacillus subtilis (270 aa) FASTA scores: opt: 353, E(): 6.5e-14, (30.0% identity in 280 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4278394 | 4279215 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3813c|Rv3813c
LKPTVPALVACDVDGTLLDDGETVTKRTRDAVHAAVDAGTHFILATGRPPRWVRPIVDALGFAPMAVCANGAVIYDPGTDRVMSVRTLPVDALATLAEVATRVIPGAGLAVERIGERAHDTATPQFVSSPGYEHAWLNPDNTEVSIDHLLSAPAIKLLIRKAGAASADMAAELAKHVGFEGDITYSTNNGLVEIVPLGISKATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVAMGNAHPDALAVADEVTAPNSEDGVARVLERWWS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant