Gene Mb3843c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3843c, -, len: 273 aa. Equivalent to Rv3813c,len: 273 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 273 aa overlap). Conserved hypothetical protein, equivalent to Q9CDB9|ML0089 HYPOTHETICAL PROTEIN from Mycobacterium leprae (281 aa) FASTA scores: opt: 1479, E(): 9.6e-81, (80.45% identity in 271 aa overlap); and similar to Q98LI0|MLL1014 from (280 aa) . Also similar to many hypothetical proteins from several organisms e.g. Q9ZBX2|SCD78.27c from Streptomyces coelicolor (280 aa),FASTA scores: opt: 597, E(): 2.2e-28, (43.25% identity in 266 aa overlap); Q9RXR7|DR0240 from Deinococcus radiodurans (284 aa), FASTA scores: opt: 543, E(): 3.5e-25, (38.65% identity in 264 aa overlap); Q99YH5|SPY1700 from Streptococcus pyogenes (274 aa) FASTA scores: opt: 373, E(): 4.3e-15, (30.75% identity in 270 aa overlap); P70947|YITU from Bacillus subtilis (270 aa) FASTA scores: opt: 353, E(): 6.5e-14, (30.0% identity in 280 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4214667 | 4215488 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3843c|Mb3843c
MKPTVPALVACDVDGTLLDDGETVTKRTRDAVHAAVDAGTHFILATGRPPRWVRPIVDALGFAPMAVCANGAVIYDPGTDRVTSVRTLPVDALATLAEVATRVIPGAGLAVERIGERAHDTATPQFVSSPGYEHAWLNPDNTEVSIDHLLSAPAIKLLIRKAGAASADMAAELAKHVGFEGDITYSTNNGLVEIVPLGISKATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVAMGNAHPDALAVADEVTAPNSEDGVARVLERWWS
Bibliography
No article yet recorded
