Gene Rv3829c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable dehydrogenase |
| Comments | Rv3829c, (MTCY409.01, MTCY01A6.40), len: 536 aa. Probable oxidoreductase dehydrogenase, similar to others e.g. Q9A3T1|CC3121 phytoene dehydrogenase-related protein from Caulobacter crescentus (543 aa), FASTA scores: opt: 607, E(): 9.2e-28, (28.25% identity in 552 aa overlap); Q98FP6|MLR3676 phytoene dehydrogenase from Rhizobium loti (Mesorhizobium loti) (521 aa), FASTA scores: opt: 605, E(): 1.2e-27, (28.2% identity in 546 aa overlap); Q97W24|SSO2422 phytoene dehydrogenase related protein from Sulfolobus solfataricus (518 aa), FASTA scores: opt: 388, E(): 4.4e-15, (27.35% identity in 530 aa overlap); Q98BS8|MLL5443 probable dehydrogenase from Rhizobium loti (Mesorhizobium loti) (524 aa), FASTA scores: opt: 374, E(): 2.9e-14, (24.35% identity in aa overlap); etc. Also similar to MTCY493.22c|Rv1432|MTCY493.22c hypothetical 50.5 KDA protein (probable dehydrogenase) from Mycobacterium tuberculosis (25.1% identity in 295 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4303398 | 4305008 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3829c|Rv3829c
MTGYDAIVIGAGHNGLTAAVLLQRAGLRTACLDAKRYAGGMASTVELFDGYRFEIAGSVQFPTSSAVSSELGLDSLPTVDLEVMSVALRGVGDDPVVQFTDPTKMLTHLHRVHGADAVTGMAGLLAWSQAPTRALGRFEAGTLPKSFDEMYACATNEFERSAIDDMLFGSVTDVLDRHFPDREKHGALRGSMTVLAVNTLYRGPATPGSAAALAFGLGVPEGDFVRWKKLRGGIGALTTHLSQLLERTGGEVRLRSKVTEIVVDNSRSSARVRGVRTAAGDTLTSPIVVSAIAPDVTINELIDPAVLPSEIRDRYLRIDHRGSYLQMHFALAQPPAFAAPYQALNDPSMQASMGIFCTPEQVQQQWEDCRRGIVPADPTVVLQIPSLHDPSLAPAGKQAASAFAMWFPIEGGSKYGGYGRAKVEMGQNVIDKITRLAPNFKGSILRYTTFTPKHMGVMFGAPGGDYCHALLHSDQIGPNRPGPKGFIGQPIPIAGLYLGSAGCHGGPGITFIPGYNAARQALADRRAANCCVLSGR
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
