Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in L-phenylalanine biosynthesis [catalytic activity: prephenate = phenylpyruvate + H(2)O + CO(2)].
ProductPrephenate dehydratase PheA
CommentsRv3838c, (MTCY01A6.31), len: 321 aa. PheA, prephenate dehydratase (see citation below), equivalent to Q9CDC4|PHEA|ML0078 putative prephenate dehydratase from Mycobacterium leprae (322 aa), FASTA scores: opt: 1690, E(): 1.3e-93, (84.25% identity in 311 aa overlap). Also highly similar to others e.g. P10341|PHEA_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (315 aa), FASTA scores: opt: 843, E(): 4e-43, (45.8% identity in 308 aa overlap); Q9ZBX0|SCD78.29c from Streptomyces coelicolor (310 aa), FASTA scores: opt: 820, E(): 9.2e-42, (46.45% identity in 312 aa overlap); Q44104|PHEA_AMYME|PDT from Amycolatopsis methanolica (304 aa), FASTA scores: opt: 707, E(): 4.9e-35, (45.7% identity in 313 aa overlap); etc. Contains PS00858 Prephenate dehydratase signature 2.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43117044312669-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3838c|pheA
VVRIAYLGPEGTFTEAALVRMVAAGLVPETGPDALQRMPVESAPAALAAVRDGGADYACVPIENSIDGSVLPTLDSLAIGVRLQVFAETTLDVTFSIVVKPGRNAADVRTLAAFPVAAAQVRQWLAAHLPAADLRPAYSNADAARQVADGLVDAAVTSPLAAARWGLAALADGVVDESNARTRFVLVGRPGPPPARTGADRTSAVLRIDNQPGALVAALAEFGIRGIDLTRIESRPTRTELGTYLFFVDCVGHIDDEAVAEALKAVHRRCADVRYLGSWPTGPAAGAQPPLVDEASRWLARLRAGKPEQTLVRPDDQGAQA
      
Bibliography