Gene Rv3842c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Glycerophosphoryl diester phosphodiesterase hydrolyzes deacylated phospholipids to G3P and the corresponding alcohols [catalytic activity: a glycerophosphodiester + H(2)O = an alcohol + SN-glycerol 3-phosphate]. |
| Product | Probable glycerophosphoryl diester phosphodiesterase GlpQ1 (glycerophosphodiester phosphodiesterase) |
| Comments | Rv3842c, (MTCY01A6.27), len: 274 aa. Probable glpQ1, glycerophosphoryl diester phosphodiesterase, equivalent to Q9CDC5|GLPQ|ML0074 putative glycerophosphoryl diester phosphodiesterase from Mycobacterium leprae (271 aa), FASTA scores: opt: 1635, E(): 1.9e-100, (88.85% identity in 269 aa overlap). Also highly similar to others e.g. CAC44700|SCBAC25E3.13c putative phosphodiesterase from Streptomyces coelicolor (275 aa), FASTA scores: opt: 413, E(): 5.7e-20, (48.05% identity in 258 aa overlap); P37965|GLPQ_BACSU glycerophosphoryl diester phosphodiesterase from Bacillus subtilis (293 aa), FASTA scores: opt: 405, E(): 2e-19, (31.3% identity in 249 aa overlap); Q99VC9|GLPQ|SA0820 glycerophosphoryl diester phosphodiesterase from Staphylococcus aureus subsp. aureus N315 (309 aa) FASTA scores: opt: 341, E(): 3.5e-15, (29.3% identity in 273 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4314738 | 4315562 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3842c|glpQ1
MTWADEVLAGHPFVVAHRGASAARPEHTLAAYDLALKEGADGVECDVRLTRDGHLVCVHDRRLDRTSTGAGLVSTMTLAQLRELEYGAWHDSWRPDGSHGDTSLLTLDALVSLVLDWHRPVKIFVETKHPVRYGSLVENKLLALLHRFGIAAPASADRSRAVVMSFSAAAVWRIRRAAPLLPTVLLGKTPRYLTSSAATAVGATAVGPSLPALKEYPQLVDRSAAQGRAVYCWNVDEYEDIDFCREVGVAWIGTHHPGRTKAWLEDGRANGTTR
Bibliography
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant