Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionRequired for the transposition of an insertion sequence.
ProductPossible transposase
CommentsRv3844, (MTCY01A6.25), len: 163 aa. Possible transposase, identical to P96234|Rv3348|MTV004.04 putative transposase from Mycobacterium tuberculosis. Also some similarity with others e.g. N-terminal part of P19834|YI11_STRCL insertion element IS116 hypothetical 44.8 KDA protein from Streptomyces clavuligerus (399 aa) FASTA scores: opt: 146, E(): 0.017, (29.1% identity in 158 aa overlap).
Functional categoryInsertion seqs and phages
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43187754319266+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3844|Rv3844
VTAENPGRSRRTLVGIDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR