Gene Mb3874 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible transposase | 
| Comments | Mb3874, -, len: 163 aa. Equivalent to Rv3844, len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 163 aa overlap). Possible transposase,identical to P96234|Rv3348|MTV004.04 PUTATIVE TRANSPOSASE from Mycobacterium tuberculosis. Also some similarity with others e.g. N-terminal part of P19834|YI11_STRCL INSERTION ELEMENT IS116 HYPOTHETICAL 44.8 KDA PROTEIN from Streptomyces clavuligerus (399 aa) FASTA scores: opt: 146,E(): 0.017, (29.1% identity in 158 aa overlap). | 
| Functional category | Insertion seqs and phages | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 4255048 | 4255539 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb3874|Mb3874
MTAENPGRSRRTLVGIDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR
      
    Bibliography
    No article yet recorded