Gene Mb3874
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible transposase |
| Comments | Mb3874, -, len: 163 aa. Equivalent to Rv3844, len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 163 aa overlap). Possible transposase,identical to P96234|Rv3348|MTV004.04 PUTATIVE TRANSPOSASE from Mycobacterium tuberculosis. Also some similarity with others e.g. N-terminal part of P19834|YI11_STRCL INSERTION ELEMENT IS116 HYPOTHETICAL 44.8 KDA PROTEIN from Streptomyces clavuligerus (399 aa) FASTA scores: opt: 146,E(): 0.017, (29.1% identity in 158 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4255048 | 4255539 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3874|Mb3874
MTAENPGRSRRTLVGIDAAITACHHIAIRDDVGARSIRFSVEPTLAGLRTLTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMAGARHCARLRGAIVGKSKSDVIDAEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVIDANRSWRRLMSLAR
Bibliography
No article yet recorded