Gene Rv3856c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3856c, (MTCY01A6.12), len: 335 aa. Conserved hypothetical protein, highly similar to various proteins from diverse organisms e.g. Q9EWR3|3SCF60.21 conserved hypothetical protein from Streptomyces coelicolor (372 aa) FASTA scores: opt: 1286, E(): 2.4e-73, (64.0% identity in 336 aa overlap); P72464|ORF1 from Streptomyces lividans (343 aa), FASTA scores: opt: 1275, E(): 1.1e-72, (60.1% identity in 336 aa overlap); Q9K899|BH3107 DNA-dependent DNA polymerase beta chain from Bacillus halodurans (571 aa), FASTA scores: opt: 592, E(): 1.2e-29, (39.15% identity in 240 aa overlap); etc. May be a DNA polymerase beta (gene name: yshC) (see citation below). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4328401 | 4329408 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3856c|Rv3856c
MDPVTALRQIAYYKDRNRHDPRRVMAYRNAADIIEGLDDAARQRHGQANSWQSLAGIGPKTAKVIAQAWSGREPDLLAELRADAEDLGGGAIRAALRGDLHLHSNWSDGSAPIEEMMATAAALGHQYCALTDHSPRLTIANGLSPDRLRKQLDVIDELREKFAPLRILTGIEVDILEDGSLDQEPEMLDRLDIVVASVHSKLSMDSAAMTRRMVRAVANGHTDVLGHCTGRLIAGNRGIRPESKFDAEAVFTACREHGTAVEINSRPERRDPPTRLLHLARDIGCVFSIDTDAHAPGQLDFLGYGAQRALDAEVPADRIVNTWPADTLLAWTGSH
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
