Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductESX conserved component EccCa1. ESX-1 type VII secretion system protein. Possible transmembrane protein.
CommentsRv3870, (MTV027.05), len: 747 aa. EccCa1, esx conserved component, ESX-1 type VII secretion system protein, possible transmembrane protein, equivalent to O33087|ML0053|MLCB628.16c putative membrane protein from Mycobacterium leprae (744 aa), FASTA scores: opt: 4333, E(): 0, (85.4% identity in 746 aa overlap); and similar to N-terminal end of others e.g. Q9CD30|ML2535 hypothetical protein from Mycobacterium leprae (1329 aa), FASTA scores: opt: 1003, E(): 1e-52, (33.65% identity in 725 aa overlap); O86653|SC3C3.20c ATP/GTP binding protein from Streptomyces coelicolor (1321 aa), FASTA scores: opt: 1078, E(): 3e-57, (35.4% identity in 774 aa overlap); P71068|YUKA YUKA protein from Bacillus subtilis (1207 aa) FASTA scores: opt: 529, E(): 4.3e-24, (26.1% identity in 636 aa overlap); Q9KE81|BH0975 hypothetical protein from Bacillus halodurans (1489 aa), FASTA scores: opt: 455, E(): 1.5e-19, (27.1% identity in 734 aa overlap); etc. Also similar to N-terminal end of hypothetical proteins from Mycobacterium tuberculosis e.g. O53689|Rv0284|MTV035.12 (1330 aa), FASTA scores: opt: 982, E(): 1.9e-51, (33.8% identity in 719 aa overlap); O06264|Rv3447c|MTCY77.19c (1236 aa), FASTA scores: opt: 761, E(): 4.1e-38, (38.2% identity in 746 aa overlap); O53935|Rv1784|MTV049.06 (932 aa), FASTA scores: opt: 547, E(): 2.8e-25, (36.25% identity in 276 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). Note some similarity (with hypothetical proteins from Mycobacterium tuberculosis and P71068|YUKA) continues in downstream ORF MTV027.06.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h of starvation (see transcriptome citation).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). In THP-1 cells, M. tuberculosis H37Rv Rv3870 mutant is attenuated for growth and cytotoxicity; in C57BL/6 mouse lungs, growth and histopathology are attenuated; Rv3875 protein not detected by Western blot in culture filtrate of mutant; Rv3874 protein levels in cell pellet are comparable to wild-type but are reduced in culture filtrate, by ELISPOT (See Guinn et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43464814348724+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3870|eccCa1
MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAMLGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINADRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRPANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWVVKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHPPDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLSDLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGSAYRIRVHEDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITGTILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFGHELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMTHPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTGELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDEFAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNLTYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFYISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP
      
Bibliography