Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3897c, (MTCY15F10.15), len: 210 aa. Conserved hypothetical protein, highly similar in part to Q10691|YK83_MYCTU|Rv2083|MT2145|MTCY49.22 hypothetical 30.8 KDA protein from Mycobacterium tuberculosis (314 aa) FASTA scores: opt: 815, E(): 4.7e-26, (73.05% identity in 167 aa overlap). Similarity to MTCY49.22 suggests that this is a continuation of MTCY15F10.14. There is a frameshift mutation near 3'-end with respect to this sequence as well, similarity to MTCY49.22 continues in an overlapping ORF. Sequence appears to be correct.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43830084383640-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3897c|Rv3897c
MMQQAVSGITGALGGAVGGVMGPLTQLPQQAMQAGQGAMQPLMSALQQTYGAEGLDVADGARLVDSIEGEPGLGGEPGAGDVGAGGGGGGTTPTGYLGPPPVPTSSPPTTPAGAPAKSVTPDPVSGTPRASGPAGMTGMPMVPPGALGAGAEGANKDKPVEKRVTGCAEWSTGQGPLNSTAECSGEICRRQAGGHQVDATDPCCAERRQG