Gene Rv3897c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3897c, (MTCY15F10.15), len: 210 aa. Conserved hypothetical protein, highly similar in part to Q10691|YK83_MYCTU|Rv2083|MT2145|MTCY49.22 hypothetical 30.8 KDA protein from Mycobacterium tuberculosis (314 aa) FASTA scores: opt: 815, E(): 4.7e-26, (73.05% identity in 167 aa overlap). Similarity to MTCY49.22 suggests that this is a continuation of MTCY15F10.14. There is a frameshift mutation near 3'-end with respect to this sequence as well, similarity to MTCY49.22 continues in an overlapping ORF. Sequence appears to be correct. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4383008 | 4383640 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3897c|Rv3897c
MMQQAVSGITGALGGAVGGVMGPLTQLPQQAMQAGQGAMQPLMSALQQTYGAEGLDVADGARLVDSIEGEPGLGGEPGAGDVGAGGGGGGTTPTGYLGPPPVPTSSPPTTPAGAPAKSVTPDPVSGTPRASGPAGMTGMPMVPPGALGAGAEGANKDKPVEKRVTGCAEWSTGQGPLNSTAECSGEICRRQAGGHQVDATDPCCAERRQG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
