Gene Rv3900c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical alanine rich protein |
| Comments | Rv3900c, (MTCY15F10.12), len: 311 aa. Conserved hypothetical ala-rich protein, highly similar to N-terminal end of Q10690|YK82_MYCTU|Rv2082|MTCY49.21 hypothetical 73.6 KDA protein from Mycobacterium tuberculosis (721 aa), FASTA scores: opt: 592, E(): 2.7e-22, (37.15% identity in 280 aa overlap). Note that MTCY15F10.12 and MTCY15F10.13 appear frameshifted with respect to MTCY49.21 although the sequence appears to be correct. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4385373 | 4386308 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3900c|Rv3900c
VVAADLPPGRWSAVLVGPWWPAPSAALRAAAQHWATWAMQKQELARNLISQHDLLLRNQGRTAEDLIGRYLRGAKSEVTKAEKYEIKKGAFNTAADAIDYLRSRLTGIAGEGNKEIDDVLASKKPLPEQLAEIQAIQTRCNADAANASRDAVDKVMTAMQEILEAEDIGDDPRTWARANGFNVDDAPPPRLIRENDLAALTGPGARGGSFGSVEGAGDLASPQSVGAGGFSGSGVQAACSQPAPRAIGASSRHASAGPVPPAPVVTTPAAATPPVIATGPRWRCPAGRCRRRPSDRAYRLRRLGNRLRPGW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant