Gene Rv3907c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcription mechanism [catalytic activity: N ATP + (nucleotide)(M) = N diphosphate + (nucleotide)(M+N)]. |
| Product | Probable poly(A) polymerase PcnA (polynucleotide adenylyltransferase) (NTP polymerase) (RNA adenylating enzyme) (poly(A) polymerase) |
| Comments | Rv3907c, (MTCY15F10.04), len: 480 aa. Probable pcnA, polynucleotide polymerase, equivalent to Q9CCY1|PCNA|ML2697 PCNA protein from Mycobacterium leprae (486 aa), FASTA scores: opt: 2713, E(): 4.3e-160, (84.1% identity in 478 aa overlap); and Q59534|PCNB POLYA polymerase from Mycobacterium leprae (411 aa) FASTA scores: opt: 2077, E(): 7.1e-121, (82.55% identity in 373 aa overlap). Also highly similar to many e.g. Q9X8T2|SCH24.18 putative RNA nucleotidyltransferase from Streptomyces coelicolor (483 aa), FASTA scores: opt: 1856, E(): 3.7e-107, (61.55% identity in 455 aa overlap); Q9ZN65 POLYA polymerase from Prevotella ruminicola (Bacteroides ruminicola) (479 aa), FASTA scores: opt: 830, E(): 8.5e-44, (34.85% identity in 445 aa overlap); P42977|PAPS_BACSU poly(A) polymerase from Bacillus subtilis (397 aa), FASTA scores: opt: 479, E(): 3.5e-22, (29.35% identity in 450 aa overlap); etc. Contains: PS00017 ATP/GTP-binding site motif A (P-loop), PS00018 EF-hand calcium-binding domain, and probably less significant a PS00237 G-protein coupled receptor signature, and PS00639 Eukaryotic thiol (cysteine) proteases histidine active site. Belongs to the tRNA nucleotidyltransferase / poly(A) polymerase family. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4391631 | 4393073 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3907c|pcnA
VPEAVQEADLLTAAAVALNRHAALLRELGSVFAAAGHELYLVGGSVRDALLGRLSPDLDFTTDARPERVQEIVRPWADAVWDTGIEFGTVGVGKSDHRMEITTFRADSYDRVSRHPEVRFGDCLEGDLVRRDFTTNAMAVRVTATGPGEFLDPLGGLAALRAKVLDTPAAPSGSFGDDPLRMLRAARFVSQLGFAVAPRVRAAIEEMAPQLARISAERVAAELDKLLVGEDPAAGIDLMVQSGMGAVVLPEIGGMRMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDIGKPATRRHEPDGGVSFHHHEVVGAKMVRKRMRALKYSKQMIDDISQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGALLPRLHKLVRADCTTRNKRRAARLQASYDRLEERIAELAAQEDLDRVRPDLDGNQIMAVLDIPAGPQVGEAWRYLKELRLERGPLSTEEATTELLSWWKSRGNR
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant