Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcription mechanism [catalytic activity: N ATP + (nucleotide)(M) = N diphosphate + (nucleotide)(M+N)].
ProductProbable poly(A) polymerase PcnA (polynucleotide adenylyltransferase) (NTP polymerase) (RNA adenylating enzyme) (poly(A) polymerase)
CommentsRv3907c, (MTCY15F10.04), len: 480 aa. Probable pcnA, polynucleotide polymerase, equivalent to Q9CCY1|PCNA|ML2697 PCNA protein from Mycobacterium leprae (486 aa), FASTA scores: opt: 2713, E(): 4.3e-160, (84.1% identity in 478 aa overlap); and Q59534|PCNB POLYA polymerase from Mycobacterium leprae (411 aa) FASTA scores: opt: 2077, E(): 7.1e-121, (82.55% identity in 373 aa overlap). Also highly similar to many e.g. Q9X8T2|SCH24.18 putative RNA nucleotidyltransferase from Streptomyces coelicolor (483 aa), FASTA scores: opt: 1856, E(): 3.7e-107, (61.55% identity in 455 aa overlap); Q9ZN65 POLYA polymerase from Prevotella ruminicola (Bacteroides ruminicola) (479 aa), FASTA scores: opt: 830, E(): 8.5e-44, (34.85% identity in 445 aa overlap); P42977|PAPS_BACSU poly(A) polymerase from Bacillus subtilis (397 aa), FASTA scores: opt: 479, E(): 3.5e-22, (29.35% identity in 450 aa overlap); etc. Contains: PS00017 ATP/GTP-binding site motif A (P-loop), PS00018 EF-hand calcium-binding domain, and probably less significant a PS00237 G-protein coupled receptor signature, and PS00639 Eukaryotic thiol (cysteine) proteases histidine active site. Belongs to the tRNA nucleotidyltransferase / poly(A) polymerase family.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43916314393073-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3907c|pcnA
VPEAVQEADLLTAAAVALNRHAALLRELGSVFAAAGHELYLVGGSVRDALLGRLSPDLDFTTDARPERVQEIVRPWADAVWDTGIEFGTVGVGKSDHRMEITTFRADSYDRVSRHPEVRFGDCLEGDLVRRDFTTNAMAVRVTATGPGEFLDPLGGLAALRAKVLDTPAAPSGSFGDDPLRMLRAARFVSQLGFAVAPRVRAAIEEMAPQLARISAERVAAELDKLLVGEDPAAGIDLMVQSGMGAVVLPEIGGMRMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDIGKPATRRHEPDGGVSFHHHEVVGAKMVRKRMRALKYSKQMIDDISQLVYLHLRFHGYGDGKWTDSAVRRYVTDAGALLPRLHKLVRADCTTRNKRRAARLQASYDRLEERIAELAAQEDLDRVRPDLDGNQIMAVLDIPAGPQVGEAWRYLKELRLERGPLSTEEATTELLSWWKSRGNR