Gene Rv3908
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible mutator protein MutT4 |
| Comments | Rv3908, (MTCY15F10.03c), len: 248 aa. Possible mutT4, mutator protein, equivalent to Q50195|ML2698|L222-ORF6 hypothetical protein from Mycobacterium leprae (251 aa), FASTA scores: opt: 1270, E(): 3.4e-62, (79.05% identity in 248 aa overlap). Also similar to O66548|APFA|AQ_158 hydrolase from Aquifex aeolicus (134 aa), FASTA scores: opt: 300, E(): 1.1e-09, (37.3% identity in 142 aa overlap); and similarity with other various proteins e.g. O93721 diadenosine 5'5'''-P1,P4-tetraphosphate pyrophosphohydrolase from Pyrobaculum aerophilum (143 aa), FASTA scores: opt: 205, E(): 0.00017, (34.85% identity in 109 aa overlap); Q9HS29|APA|VNG0431G diadenosine tetraphosphate pyrophosphohydrolase from Halobacterium sp. strain NRC-1 (142 aa), FASTA scores: opt: 199, E(): 0.00036, (34.0% identity in 147 aa overlap); Q9YA58|APE2080 hypothetical 19.2 KDA protein from Aeropyrum pernix (175 aa) FASTA scores: opt: 191, E(): 0.0012, (36.9% identity in 141 aa overlap); etc. Also similar to P95110|MUTT1|Rv2985|MTCY349.02 hypothetical 34.7 KDA protein from Mycobacterium tuberculosis (317 aa) FASTA scores: opt: 224, E(): 3e-05, (34.05% identity in 144 aa overlap). Predicted to be an outer membrane protein (See Song et al., 2008). Seems to belong to the NUDIX hydrolase family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4393449 | 4394195 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3908|mutT4
VSDGEQAKSRRRRGRRRGRRAAATAENHMDAQPAGDATPTPATAKRSRSRSPRRGSTRMRTVHETSAGGLVIDGIDGPRDAQVAALIGRVDRRGRLLWSLPKGHIELGETAEQTAIREVAEETGIRGSVLAALGRIDYWFVTDGRRVHKTVHHYLMRFLGGELSDEDLEVAEVAWVPIRELPSRLAYADERRLAEVADELIDKLQSDGPAALPPLPPSSPRRRPQTHSRARHADDSAPGQHNGPGPGP
Bibliography
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Ebrahimi-Rad M et al. [2003]. Mutations in putative mutator genes of Mycobacterium tuberculosis strains of the W-Beijing family. Product
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dos Vultos T, Blazquez J, Rauzier J, Matic I and Gicquel B [2006]. Identification of Nudix hydrolase family members with an antimutator role in Mycobacterium tuberculosis and Mycobacterium smegmatis. Biochemistry Mutant
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
