Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productpossible mutator protein mutt4
CommentsMb3938, -, len: 248 aa. Equivalent to Rv3908, len: 248 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 248 aa overlap). Conserved hypothetical protein, equivalent to Q50195|ML2698|L222-ORF6 HYPOTHETICAL PROTEIN from Mycobacterium leprae (251 aa), FASTA scores: opt: 1270,E(): 3.4e-62, (79.05% identity in 248 aa overlap). Also similar to O66548|APFA|AQ_158 HYDROLASE from Aquifex aeolicus (134 aa), FASTA scores: opt: 300, E(): 1.1e-09,(37.3% identity in 142 aa overlap); and similarity with other various proteins e.g. O93721 DIADENOSINE 5'5'''-P1,P4-TETRAPHOSPHATE PYROPHOSPHOHYDROLASE from Pyrobaculum aerophilum (143 aa), FASTA scores: opt: 205,E(): 0.00017, (34.85% identity in 109 aa overlap); Q9HS29|APA|VNG0431G DIADENOSINE TETRAPHOSPHATE PYROPHOSPHOHYDROLASE from Halobacterium sp. strain NRC-1 (142 aa), FASTA scores: opt: 199, E(): 0.00036, (34.0% identity in 147 aa overlap); Q9YA58|APE2080 HYPOTHETICAL 19.2 KDA PROTEIN from Aeropyrum pernix (175 aa) FASTA scores: opt: 191, E(): 0.0012, (36.9% identity in 141 aa overlap); etc. Also similar to P95110|MUTT1|Rv2985|MTCY349.02 HYPOTHETICAL 34.7 KDA PROTEIN from Mycobacterium tuberculosis (317 aa) FASTA scores: opt: 224, E(): 3e-05, (34.05% identity in 144 aa overlap).
Functional categoryInformation pathways
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43274104328156+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3938|mutt4
MSDGEQAKSRRRRGRRRGRRAAATAENHMDAQPAGDATPTPATAKRSRSRSPRRGSTRMRTVHETSAGGLVIDGIDGPRDAQVAALIGRVDRRGRLLWSLPKGHIELGETAEQTAIREVAEETGIRGSVLAALGRIDYWFVTDGRRVHKTVHHYLMRFLGGELSDEDLEVAEVAWVPIRELPSRLAYADERRLAEVADELIDKLQSDGPAALPPLPPSSPRRRPQTHSRARHADDSAPGQHNGPGPGP
      
Bibliography
No article yet recorded