Gene Rv3919c (gidB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable glucose-inhibited division protein B Gid |
| Comments | Rv3919c, (MT4038, MTV028.10c), len: 224 aa. Probable gid (alternate gene name: gidB), glucose-inhibited division protein B, equivalent, but shorter 20 aa, to Q9L7M3 putative GIDB (fragment) from Mycobacterium paratuberculosis (245 aa), FASTA scores: opt: 1018, E(): 4.8e-57, (73.95% identity in 211 aa overlap); and Q50203|GIDB_MYCLE|ML2708 glucose inhibited division protein B from Mycobacterium leprae (245 aa), FASTA scores: opt: 966, E(): 9.1e-54, (68.4% identity in 212 aa overlap). Also highly similar to many e.g. O54571|GIDB_STRCO|STH24.07 from Streptomyces coelicolor (239 aa), FASTA scores: opt: 654, E(): 3.9e-34, (47.95% identity in 221 aa overlap); Q9KNG5|VC2774 from Vibrio cholerae (210 aa), FASTA scores: opt: 300, E(): 6.9e-12, (38.15% identity in 139 aa overlap); P17113|GIDB_ECOLI|B3740|Z5240|ECS4682 from Escherichia coli (several strains) (207 aa), FASTA scores: opt: 287, E(): 4.5e-11, (34.8% identity in 138 aa overlap); etc. Contains PS00539 Pyrokinins signature. Belongs to the GIDB family. Nucleotide position 4407904 in the genome sequence has been corrected, G:A resulting in S100F. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4407528 | 4408202 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3919c|gid
MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLWDRHLLNCAVIGELLERGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREMVTDLGVAVEIVRGRAEESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIKGERAHDEVREHRRVMIASGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGGTA
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
