Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved protein similar to jag protein
CommentsRv3920c, (MTV028.11c), len: 187 aa. Conserved protein, similar to jag protein, equivalent to Q9L7M2 hypothetical 20.1 KDA protein from Mycobacterium paratuberculosis (183 aa), FASTA scores: opt: 1004, E(): 7.3e-52, (85.05% identity in 187 aa overlap); and Q50204|ML2709 hypothetical protein similar to jag protein SPOIIIJ associated protein in bacillus subtilis from Mycobacterium leprae (193 aa), FASTA scores: opt: 871, E(): 4.4e-44, (73.05% identity in 193 aa overlap). Also similar to other bacterial proteins e.g. O54595|STH24.06|jag jag-like protein from Streptomyces coelicolor (170 aa), FASTA scores: opt: 593, E(): 6.7e-28, (62.85% identity in 167 aa overlap); Q9RCA6|jag|BH4063 jag protein homolog from Bacillus halodurans (207 aa), FASTA scores: opt: 282, E(): 1.1e-09, (35.0% identity in 140 aa overlap); Q9X1H1|TM1460 putative jag protein, putative from Thermotoga maritima (221 aa), FASTA scores: opt: 258, E(): 3e-08, (31.9% identity in 138 aa overlap);Q01620|JAG_BACSU jag protein (SPOIIIJ associated protein) from Bacillus subtilis (208 aa), FASTA scores: opt: 196, E(): 0.00012, (28.05% identity in 139 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS44083344408897-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3920c|Rv3920c
MADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIAGDYLEELLDVLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVHQKTGVRSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVPMTPFERKIVHDAVAAVPGVHSESEGVEPERRVVVLRD