Gene Rv3920c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved protein similar to jag protein |
| Comments | Rv3920c, (MTV028.11c), len: 187 aa. Conserved protein, similar to jag protein, equivalent to Q9L7M2 hypothetical 20.1 KDA protein from Mycobacterium paratuberculosis (183 aa), FASTA scores: opt: 1004, E(): 7.3e-52, (85.05% identity in 187 aa overlap); and Q50204|ML2709 hypothetical protein similar to jag protein SPOIIIJ associated protein in bacillus subtilis from Mycobacterium leprae (193 aa), FASTA scores: opt: 871, E(): 4.4e-44, (73.05% identity in 193 aa overlap). Also similar to other bacterial proteins e.g. O54595|STH24.06|jag jag-like protein from Streptomyces coelicolor (170 aa), FASTA scores: opt: 593, E(): 6.7e-28, (62.85% identity in 167 aa overlap); Q9RCA6|jag|BH4063 jag protein homolog from Bacillus halodurans (207 aa), FASTA scores: opt: 282, E(): 1.1e-09, (35.0% identity in 140 aa overlap); Q9X1H1|TM1460 putative jag protein, putative from Thermotoga maritima (221 aa), FASTA scores: opt: 258, E(): 3e-08, (31.9% identity in 138 aa overlap);Q01620|JAG_BACSU jag protein (SPOIIIJ associated protein) from Bacillus subtilis (208 aa), FASTA scores: opt: 196, E(): 0.00012, (28.05% identity in 139 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4408334 | 4408897 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3920c|Rv3920c
MADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIAGDYLEELLDVLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVHQKTGVRSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVPMTPFERKIVHDAVAAVPGVHSESEGVEPERRVVVLRD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant