Gene mtbc0_002766
in Mycobacterium tuberculosis MTBC0
General annotation
| Type | CDS |
| Function | Unknown |
| Product | DUF4247 domain-containing protein |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2951030 | 2951461 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis MTBC0|mtbc0_002766|mtbc0_002766
MSRNRLFLVAGILAVAAAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARASHTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSPGGPGGSK
Bibliography