Gene ML0067c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible histone-like protein Hns |
| Comments | ML0067c, len: 121 aa. Possible hns, histone-like protein, similar to Rv3852|P96225|AL123456 hns, HU-histone protein from M. tuberculosis (134 aa), Fasta scores: E(): 6.1e-12, (51.5% identity in 134 aa overlap). Contains PAKKX repeats similar to those in histone H1 proteins. |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 88741 | 89106 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0067c|hns
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQSLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVALVIALAIGLLALLLIHQLRRR
Bibliography
No article yet recorded