Gene ML0523
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | N utilization substance protein NusB (NusB protein) |
Comments | ML0523, len: 190 aa. nusB, N utilization substance protein, highly similar but longer to NUSB_MYCTU|P95020|Rv2533c nusB, putative transcription termination protein from M. tuberculosis (156 aa), Fasta scores: E(): 1e-43, (75.7% identity in 148 aa overlap); CAD94747|Mb2562c from M. bovis (156 aa). Also similar to many e.g. P54520|NUSB_BACSU from Bacillus subtilis (131 aa), FASTA scores: E(): 6.3e-15, (41.860% identity in 129 aa overlap); and NUSB_ECOLI|P04381 nusB, N utilization substance protein B from Escherichia coli (139 aa), Fasta scores: E(): 7.4e-08, (38.1% identity in 139 aa overlap). Contains Pfam match to entry PF01029 NusB, NusB family. Belongs to the NusB family. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 633534 | 634106 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0523|nusB MSNPVKGRHQARKRAVDLLFEAEARDLSPLEIIEVRSALAKSKLDVAPLHPYTVVVAQGVSEHTARIDELIISHLQGWKLDRLPAVDRAILRVSIWELLYADDVPEPVAVDEAVELAKELSTDDSPGFVNGLLGKVMLVTPQIRAAAQAVQQAVRMAAGTSEDHVPQREPAAGQLGQDDSNGGQVAAVCR
Bibliography
No article yet recorded