Gene Rv2533c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the transcription termination process. Interacts with RPSJ|NUSE|Rv0700. |
| Product | N utilization substance protein NusB (NusB protein) |
| Comments | Rv2533c, (MT2608, MTCY159.23), len: 156 aa. NusB, N utilization substance protein (see citations below), equivalent to Q9CCR9|NUSB_MYCLE|ML0523 N utilization substance protein B from Mycobacterium leprae (190 aa), FASTA scores: opt: 749, E(): 2.6e-41, (75.7% identity in 148 aa overlap). Also highly similar to others e.g. Q9KXR0|SC9C5.14 from Streptomyces coelicolor (142 aa), FASTA scores: opt: 358, E(): 2.7e-16, (45.0% identity in 140 aa overlap); P54520|NUSB_BACSU from Bacillus subtilis (131 aa), FASTA scores: opt: 315, E(): 1.5e-13, (39.55% identity in 129 aa overlap); O83979|NUSB_TREPA|TP1015 from Treponema pallidum (141 aa), FASTA scores: opt: 268, E(): 1.6e-10, (36.95% identity in 138 aa overlap); etc. Belongs to the NusB family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2858254 | 2858724 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2533c|nusB
MSDRKPVRGRHQARKRAVALLFEAEVRGISAAEVVDTRAALAEAKPDIARLHPYTAAVARGVSEHAAHIDDLITAHLRGWTLDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKELSTDDSPGFVNGVLGQVMLVTPQLRAAAQAVRGGA
Bibliography
- Gopal B et al. [2000]. Crystallization and preliminary X-ray diffraction studies on the N-utilizing substance-B (NusB) from Mycobacterium tuberculosis. Structure
- Gopal B et al. [2000]. The crystal structure of NusB from Mycobacterium tuberculosis. Product Structure
- Gopal B et al. [2001]. Spectroscopic and thermodynamic characterization of the transcription antitermination factor NusE and its interaction with NusB from Mycobacterium tuberculosis. Secondary Product Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant