Gene ML0717c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable transcriptional regulator (TetR-family) |
| Comments | ML0717c, len: 223 aa. Probable transcriptional regulator tetR-family, highly similar to P96900|AL123456|Rv3295 putative TetR-family transcriptional regulator from M. tuberculosis (221 aa), Fasta scores: E(): 0, (85.5% identity in 220 aa overlap); and CAD95415|Mb3323 from M. bovis (221 aa). Similar to many putative transcriptional regulators e.g. Q9RD77|SCO0800|SCF43.11C Putative TetR-family transcriptional regulator from Streptomyces coelicolor (205 aa), fasta scores: opt: 443, E(): 4.9e-23, (39.500% identity in 200 aa overlap). Previously sequenced as Q49662|U00012 (242 aa), Fasta scores: E(): 0, (100.0% identity in 223 aa overlap). Contains a probable helix-turn-helix motif at aa 33-54 (Score 1535, SD +4.42) Contains Pfam match to entry PF00440 tetR, Bacterial regulatory proteins, tetR family. SIMILAR TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 859918 | 860589 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0717c|ML0717c
MTTARRRLSPEDRRAELLALGAEVFGKRPYDEVRIDEIAERAGVSRALMYHYFPDKRAFFAAVVKDEADRLYAATNIPPPAGLTMFEEVRVGVLAYMAYHKQNPEAAWAAYVGLGRSDPVLLGIDDEAKNRQMEHIMSRIGDVVSVVPESKLHPDIERDLRVIVHGWLAFTFEVCRQRIMDPSTDADRLADSCAHALLDAIARVPEISKELADAMAIARQPPQ
Bibliography
No article yet recorded
