Gene Rv3221A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Binds sigma factor sigh and inhibits it. Probably involved in survival following heat shock and oxidative stress. |
| Product | Anti-sigma factor RshA |
| Comments | Rv3221A, len: 101 aa. RshA, anti-sigma factor, similar to Q9XCD7|AAD41811.1 unknown protein from Mycobacterium smegmatis, linked to sigma factor sigH (see Fernandes et al., 1999) (101 aa), FASTA scores: opt: 422, E(): 3.4e-22, (64.9% identity in 94 aa overlap); and to Q9RL96|RsrA anti-sigma factor from Streptomyces coelicolor (see Kang et al., 1999) (105 aa), FASTA scores: opt: 163, E(): 0.00016, (32.05% identity in 78 aa overlap). |
| Functional category | Information pathways |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).<EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3598051 | 3598356 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3221A|rshA
VSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHYGLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP
Bibliography
- Fernandes ND et al. [1999]. A mycobacterial extracytoplasmic sigma factor involved in survival following heat shock and oxidative stress. Homolog Mutant
- Kang JG et al. [1999]. RsrA, an anti-sigma factor regulated by redox change. Homolog Sequence Function
- Song T et al. [2003]. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Biochemistry Function
- Jeong EH et al. [2006]. RshA mimetic peptides inhibiting the transcription driven by a Mycobacterium tuberculosis sigma factor SigH. Biochemistry
- Park ST et al. [2008]. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Biochemistry
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
