Gene Rv1642
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Translation |
| Product | 50S ribosomal protein L35 RpmI |
| Comments | Rv1642, (MTCY06H11.06), len: 64 aa. rpmI, 50S ribosomal protein L35, similar to several e.g. RL35_SYNY3|P48959 from Synechocystis sp. (67 aa), fasta scores: opt: 179, E(): 2.7e-08, (51.6% identity in 64 aa overlap). Belongs to the L35P family of ribosomal proteins. |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002). |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1852928 | 1853122 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1642|rpmI
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTSLLNG
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
