Gene MMAR_1334
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | alternative sigma factor that plays a role in the oxidative-stress response (regulation of thioredoxin recycling). the sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. this sigma factor is involved in heat shock and oxidative stress response; it is believed to control protein processing in the extracytoplasmic compartment. regulates positively DnaK and ClpB genes. regulates TrxB2, TrxC, and SigB genes. SigH may mediate the transcription of at least 31 genes directly and modulates the expression of about 150 others. |
| Product | alternative RNA polymerase sigma-E factor (sigma-24) SigH (RpoE) |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1627492 | 1628259 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1334|sigH
VSTSTSLLGEERLGRFPASPASVATLSGGTSTEGTVFIKMADIDGVTLAEAPDPEPPEETDEQLTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTDEITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRTLLADVAKERGFVRGEQAHQEVSS
Bibliography
No article yet recorded
