Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAlternative sigma factor that plays a role in the oxidative-stress response (regulation of thioredoxin recycling). The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. This sigma factor is involved in heat shock and oxidative stress response; it is believed to control protein processing in the extracytoplasmic compartment. Regulates positively DNAK and CLPB genes. Regulates TRXB2, TRXC, Rv2466c and SIGB genes, and probably SIGB gene. SigH may mediate the transcription of at least 31 genes directly and modulates the expression of about 150 others.
ProductAlternative RNA polymerase sigma-E factor (sigma-24) SigH (RPOE)
CommentsRv3223c, (MTCY07D11.03), len: 216 aa. SigH (alternate gene name: rpoE), alternative RNA polymerase sigma factor (see citations below), similar to many e.g. Q9XCD8|sigh from Mycobacterium smegmatis (215 aa), FASTA scores: opt: 1187, E(): 8.1e-69, (87.75% identity in 212 aa overlap); O87834|SIGR from Streptomyces coelicolor (227 aa), FASTA scores: opt: 913, E(): 2.6e-51, (68.8% identity in 202 aa overlap); O68520|RPOE1 from Myxococcus xanthus (213 aa), FASTA scores: opt: 452, E(): 6.7e-22, (42.8% identity in 187 aa overlap); Q06198|RPSH_PSEAE|ALGU|ALGT|PA0762 from Pseudomonas aeruginosa (193 aa), FASTA scores: opt: 301, E(): 2.7e-12, (29.9% identity in 194 aa overlap); etc. Equivalent to AAK47662 RNA polymerase sigma-70 factor from Mycobacterium tuberculosis strain CDC1551 (284 aa), but shorter 68 aa. Has sigma-70 factors ECF subfamily signature (PS01063). So belongs to the sigma-70 factor family, ECF subfamily. Start chosen on basis of similarity, other potential starts upstream.
Functional categoryInformation pathways
ProteomicsThe product of this CDS corresponds to a spot identified in cytosol by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by SCOTS method, during infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level increases after heat shock (see Manganelli et al., 1999; Stewart et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Transposon mutant is hypersensitive to acidified nitrite (See Darwin et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35989013599551-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3223c|sigH
MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
      
Bibliography