Gene MMAR_1801
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | essential for efficient processing of 16S rRNA. probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. it could be some accessory protein needed for efficient assembly of the 30S subunit. RimM is needed in a step prior to RbfA during the maturation of 16S rRNA. has affinity for free ribosomal 30S subunits but not for 70S ribosomes. |
| Product | 16S rRNA processing protein RimM |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2198476 | 2199000 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1801|rimM
MELVIGRVVKAHGITGEVVVEIRTDEPDRRFTPGASLRAKRSRDGGTGRNYVIEGVREHGARLLVRLAGVNDRDTADGLRGSLFVIDSADLPPIDEPDTYYDHQLEGLRVRTTAGQDVGVVAEVLHTGAGELLAVKCDSGEVLVPFVGAIVTSVSLDDRILEIDPPDGLLDLGS
Bibliography
No article yet recorded