Gene Rv2907c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Essential for efficient processing of 16S rRNA. Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. It could be some accessory protein needed for efficient assembly of the 30S subunit. RIMM is needed in a step prior to RBFA during the maturation of 16S rRNA. Has affinity for free ribosomal 30S subunits but not for 70S ribosomes. |
| Product | Probable 16S rRNA processing protein RimM |
| Comments | Rv2907c, (MTCY274.38c), len: 176 aa. Probable rimM, 16S rRNA processing protein, equivalent to O33016|RIMM_MYCLE probable 16S rRNA processing protein from Mycobacterium leprae (179 aa), FASTA scores: opt: 797, E(): 2.4e-46, (73.15% identity in 175 aa overlap). Also highly similar to others e.g. O69881|RIMM_STRCO from Streptomyces coelicolor (188 aa), FASTA scores: opt: 485, E(): 2.3e-25, (48.85% identity in 176 aa overlap); Q9KA14|RIMM_BACHD from Bacillus halodurans (173 aa), FASTA scores: opt: 289, E(): 3.2e-12, (30.65% identity in 173 aa overlap); P21504|RIMM_ECOLI|RIMM|B2608 from Escherichia coli strain K12 (182 aa), FASTA scores: opt: 237, E(): 1e-08, (29.4% identity in 177 aa overlap). Belongs to the RimM family. |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3216361 | 3216891 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2907c|rimM
MELVVGRVVKSHGVTGEVVVEIRTDDPADRFAPGTRLRAKGPFDGGAEGSAVSYVIESVRQHGGRLLVRLAGVADRDAADALRGSLFVIDADDLPPIDEPDTYYDHQLVGLMVQTATGEGVGVVTEVVHTAAGELLAVKRDSDEVLVPFVRAIVTSVSLDDGIVEIDPPHGLLNLE
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
