Gene Mb0022c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable transcriptional regulatory protein whib-like whib5 |
Comments | Mb0022c, whiB5, len: 139 aa. Equivalent to Rv0022c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Probable whiB5,WhiB-like regulatory protein (see citation below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Shows some similarity to O88103|AJ239086|SCO239086_1|WHID|SC6G4.45c|WBLB WHID PROTEIN from Streptomyces coelicolor (112 aa), FASTA scores: opt: 125, E(): 0.055, (37.1% identity in 97 aa overlap); and slight similarity to G466960|WHIB WHIB PROTEIN (102 aa), FASTA scores: opt: 112, E(): 0.14, (34.3 identity in 67 aa overlap). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 27004 | 27423 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0022c|whiB5 MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRCPLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLPDNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA
Bibliography
No article yet recorded