Gene Rv0022c (whmG)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein WhiB-like WhiB5 |
| Comments | Rv0022c, (MTCY10H4.22c), len: 139 aa. Probable whiB5 (alternate gene name: whmG), WhiB-like regulatory protein (see citations below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 27023 | 27442 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0022c|whiB5
MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRCPLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLPDNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA
Bibliography
- Hutter B and Dick T [1999]. Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor. Homolog Mutant
- Soliveri JA et al. [2000]. Multiple paralogous genes related to the Streptomyces coelicolor developmental regulatory gene whiB are present in Streptomyces and other actinomycetes. Sequence Phylogeny
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
