Gene Mb0056
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s18-1 rpsr1 |
Comments | Mb0056, rpsR1, len: 84 aa. Equivalent to Rv0055,len: 84 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 84 aa overlap). Probable rpsR1, 30S ribosomal protein S18-1, equivalent to NP_302711.1|NC_002677|O53125|RS18_MYCLE 30S RIBOSOMAL PROTEIN from Mycobacterium leprae (84 aa). Also highly similar to others e.g. Q9X8U4|R18A_STRCO 30S RIBOSOMAL PROTEIN S18-1 from Streptomyces coelicolor (78 aa); RS18_B|ACST|P10806 30s ribosomal protein s18 (bs21) (77 aa), FASTA scores: opt: 220, E(): 4e-10, (52.2% identity in 67 aa overlap); etc. Also similar to MTCY63A_5 from Mycobacterium tuberculosis. BELONGS TO THE S18P FAMILY OF RIBOSOMAL PROTEINS. Note that previously known as rpsR. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 59112 | 59366 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0056|rpsR1 MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR
Bibliography
No article yet recorded