Gene Rv0055 (rpsR)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This protein has been implicated in aminoacyl-transfer RNA binding. It appears to be situated at the decoding site of messenger RNA. |
| Product | 30S ribosomal protein S18-1 RpsR1 |
| Comments | Rv0055, (MTCY21D4.18), len: 84 aa. rpsR1, 30S ribosomal protein S18-1. Belongs to the S18P family of ribosomal proteins. Note that previously known as rpsR. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 59122 | 59376 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0055|rpsR1
MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR
Bibliography
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
