Gene Mb0072
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE MATURASE |
| Comments | Mb0072, -, len: 238 aa. Equivalent to Rv0071, len: 235 aa, from Mycobacterium tuberculosis strain H37Rv,(98.7% identity in 238 aa overlap). Possible maturase,similar to many proteins of the group II intron maturase family e.g. P95451|U77945 MATURASE-RELATED PROTEIN from PSEUDOMONAS ALCALIGENES (297 aa), FASTA scores: opt: 395,E(): 1.7e-20, (43.5% identity in 147 aa overlap); N-terminus of AAD16434.1|AF101076 maturase-related protein from Pseudomonas putida (473 aa); N-terminus of NP_437373.1|NC_003078 putative reverse transcriptasematurase protein from Sinorhizobium meliloti (453 aa); etc. Also similar to MLCL581_1 from Mycobacterium leprae. Contains 5 VDP repeats at N-terminus, these are also found in two Streptococcus plasmid hypothetical proteins Q52246|X17092 and Q54942|X66468. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 9 bp insertion (*-cggtggacc) leads to a longer product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (238 aa versus 235 aa). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 79513 | 80229 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0072|Mb0072
MSSITVSVDPVDPVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGALEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPIFETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRHRIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRYRGNTIPTPWTQAV
Bibliography
No article yet recorded
