Gene Rv0071
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible maturase |
| Comments | Rv0071, (MTV030.14), len: 235 aa. Possible maturase, similar to many proteins of the group II intron maturase family. Contains 5 VDP repeats at N-terminus, these are also found in two Streptococcus plasmid hypothetical proteins Q52246|X17092 and Q54942|X66468. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 79486 | 80193 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0071|Rv0071
MSSITVSVDPVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGALEFLNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPIFETDFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRHRIKDKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRYRGNTIPTPWTQAV
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
