Gene Mb0130
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable serine protease pepa (serine proteinase) (mtb32a) |
| Comments | Mb0130, pepA, len: 355 aa. Equivalent to Rv0125,len: 355 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 355 aa overlap). Probable pepA, serine protease (EC 3.4.21.-), highly similar to other proteases e.g. HHOB_ECOLI|P31137 protease hhob precursor (355 aa),FASTA scores: opt: 400, E(): 3.8e-14, (32.4% identity in 346 aa overlap). Also similar to Q50320 34 KDA protein precursor from Mycobacterium tuberculosis (361 aa), FASTA scores: opt: 1689, E(): 0, (70.7% identity in 362 aa overlap). Contains PS00135 Serine proteases, trypsin family, serine active site. Has a possible signal sequence at the N-terminus. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 151339 | 152406 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0130|pepA
MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPA
Bibliography
No article yet recorded