Gene Mb0174
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved integral membrane protein yrbe1b |
| Comments | Mb0174, yrbE1B, len: 289 aa. Equivalent to Rv0168,len: 289 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 289 aa overlap). yrbE1B, hypothetical unknown integral membrane protein, part of mce1 operon and member of YrbE family (see citations below for more information), highly similar to Mycobacterium tuberculosis proteins O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa); O53966|Rv1965|MTV051.03|yrbE3B (271 aa); etc. Also highly similar to conserved hypothetical integral membrane proteins of the yrbEB type, e.g. NP_302655.1|NC_002677 conserved membrane protein from Mycobacterium leprae (289 aa); P45030|YRBE_HAEIN|HI1086 hypothetical protein from Haemophilus influenzae (261 aa), FASTA scores: opt: 223,E(): 7.6e-07, (23.7% identity in 257 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 197852 | 198721 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0174|yrbE1B
MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQIAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIGVEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSISFLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFWSFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGVDPNFNLTV
Bibliography
No article yet recorded
