Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved integral membrane protein YrbE1B
CommentsRv0168, (MTCI28.08), len: 289 aa. YrbE1B, unknown integral membrane protein, part of mce1 operon and member of YrbE family (see citations below), highly similar to Mycobacterium tuberculosis proteins O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa); O53966|Rv1965|MTV051.03|yrbE3B (271 aa); etc. Also highly similar to conserved hypothetical integral membrane proteins of the yrbEB type, e.g. NP_302655.1|NC_002677 conserved membrane protein from Mycobacterium leprae (289 aa); P45030|YRBE_HAEIN|HI1086 hypothetical protein from Haemophilus influenzae (261 aa), FASTA scores: opt: 223, E(): 7.6e-07, (23.7% identity in 257 aa overlap); etc.
Functional category-
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002).
OperonRv0167 and Rv0168, Rv0168 and Rv0169 are co-transcribed, by RT-PCR (See Casali et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). RAW macrophages infected with M. tuberculosis H37Rv Rv0168 mutant produce less TNF-alpha (also in BALB/c peritoneal macrophages), IL-6, MCP-1, and NO; in RAW macrophages, increased growth and growth comparable to wild-type have been observed (See Shimono et al., 2003; Marjanovic et al., 2010); growth in C57BL/6 mice is comparable to wild-type but mice die sooner and lung pathology is more severe (See Marjanovic et al., 2010). M. tuberculosis H37Rv Rv0168 mutant growth in vitro is comparable to wild-type; BALB/c mice survive longer when infected with mutant than with wild-type; lung pathology is reduced or delayed; growth in BALB/c mice is reduced when infection is intratracheal, but increased with intraperitoneal injection (See Gioffre et al., 2005).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS197660198529+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0168|yrbE1B
MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQIAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIGVEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSISFLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFWSFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGVDPNFNLTV
      
Bibliography