Gene Mb0192A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Metallothionein, MymT |
| Comments | Mb0192A, len: 53 aa. Equivalent to Rv0186A len: 53 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 53 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). MymT,metallothionein,equivalent to MAV_4993|A0QMH5 hypothetical protein from Mycobacterium avium (strain 104) (51 aa), and MAP_3626c|Q73TU2 hypothetical protein from Mycobacterium avium subsp. paratuberculosis (51 aa), FASTA scores: opt: 312, E(): 4.6e-17, (81.2% identity in 48 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 218582 | 218743 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0192A|mymT
MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK
Bibliography
No article yet recorded