Gene Rv0186A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Coordinates Cu(I) ions into a Cu(I)-thiolate core, protects cell from copper toxicity |
| Product | Metallothionein, MymT |
| Comments | Rv0186A, len: 53 aa. MymT, metallothionein, equivalent to MAV_4993|A0QMH5 hypothetical protein from Mycobacterium avium (strain 104) (51 aa), and MAP_3626c|Q73TU2 hypothetical protein from Mycobacterium avium subsp. paratuberculosis (51 aa), FASTA scores: opt: 312, E(): 4.6e-17, (81.2% identity in 48 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Transcriptomics | Expression is upregulated by copper, cadmium, and compounds that generate nitric oxide or superoxide (See Gold et al., 2008). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). H37Rv mymT mutant is hypersensitive to copper toxicity and has no loss of virulence in mice (See Gold et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 218390 | 218551 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0186A|mymT
MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK
Bibliography
- Gold B, Deng H, Bryk R, Vargas D, Eliezer D, Roberts J, Jiang X and Nathan C [2008]. Identification of a copper-binding metallothionein in pathogenic mycobacteria. Function Product
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
