Gene Mb0207c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0207c, -, len: 167 aa. Equivalent to Rv0201c,len: 167 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 167 aa overlap). Conserved hypothetical protein, equivalent to Z95398|MLCL622.15c from Mycobacterium leprae (170 aa), FASTA scores: opt: 646, E(): 0, (63.9% identity in 158 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 238088 | 238591 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0207c|Mb0207c
MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDIATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVARQVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVRAADS
Bibliography
No article yet recorded