Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0201c, (MTV033.09c), len: 167 aa. Conserved protein, equivalent to Z95398|MLCL622.15c from Mycobacterium leprae (170 aa), FASTA scores: opt: 646, E(): 0, (63.9% identity in 158 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS237892238395-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0201c|237892-238395|-|Rv0201c|downstream:0|upstream:0
gtgacgttggcagccgagccacaccccgcaccgccgcaacaacccaccgtcgcgtggagcgagccggacgtcgaccggcgggtcgagttctggcctaccgtcgccattcgttcggcgctggaaagtggcgacatcgccacctggcaacgcatagcggccgcgctcaagcgcgacccctacgggcggacagcacgccaagtcgaagaagtcctcgagggcataccggcgaccggcatcgccaacgccttttgggaggtgctggaccgggcccgtactcacctagacgccaatgagcgcgccgaggtggcccgtcaggttgggctcctgttggaccgctctggcctgcaacgacaggaattcgcgtcgcgcattggcgtcacagcgcaggacctgaccgcctacctcgacggcatcgtgagcccgtcggcctcgctgatgatccggatgcggcggctgtcggaccggttcgtcagagccaaatccgtacgtgccgccgactcttag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0201c|Rv0201c
VTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDIATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVARQVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVRAADS