Gene Mb0308
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb2 |
| Comments | Mb0308, -, len: 73 aa. Equivalent to Rv0300, len: 73 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 73 aa overlap). Conserved hypothetical protein, similar to Rv1721c|MTCY04C12.06c|Z81360|MTCY4C12_4 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 364873 | 365094 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0308|vapb2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR
Bibliography
No article yet recorded