Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB2
CommentsRv0300, (MTCY63.05), len: 73 aa. Possible vapB2, antitoxin, part of toxin-antitoxin (TA) operon with Rv0301 (See Arcus et al., 2005; Pandey and Gerdes, 2005). Weak similarity with others e.g. Rv3697c from Mycobacterium tuberculosis (145 aa), Rv1721c|MTCY04C12.06c|Z81360|MTCY4C12_4 conserved hypothetical protein from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryVirulence, detoxification, adaptation
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS363826364047+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0300|vapB2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR